NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228602_1029252

Scaffold Ga0228602_1029252


Overview

Basic Information
Taxon OID3300024188 Open in IMG/M
Scaffold IDGa0228602_1029252 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 2D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)803
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024324Metagenome / Metatranscriptome206N
F103883Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0228602_10292521F103883AGGAGGMTKEKQSKRHQATEIIQLFREGRSDEALVLFEKYGFRKEFICFAVTRGIDYEDASDLVQKFIIGKLYMKSDSIEHIEYARTWMYMVFRNMINDQGRVLTKNREVSLDEARDQSYEEASVEKNQ
Ga0228602_10292522F024324N/AAGNFDTDILATTISTQKNNKDRLNDFKGKNINLRINFPQADGQDPAIINTDLISIFGFANLKIAFLGNFIQGQMFDSLMAYFNTIRIEVTNPHKIYFDIPSDEYSLNGYVAAKLKAKELCEDIVKTTSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.