Scaffold Ga0228602_1021076

Overview

Basic Information

• Taxon OID: 3300024188
• Scaffold ID: Ga0228602_1021076
• Source Dataset Name: Seawater microbial communities from Monterey Bay, California, United States - 2D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 898
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.8313
  • Long. (^o): -121.9047
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045552	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228602_10210763	F045552	GAGG	MQTQTFTQHEKDFVVEFLADILHGLTINNVLSRQDADGFVRMQDALEVLDNLKMLYVKHDEDAAQDWVAGESKATWTFTIDDANTELTNYDTEYREGICEQFEEACTDASTDKANADLDCDWATLAQRVTGYEY