Scaffold Ga0247672_1082343

Overview

Basic Information

• Taxon OID: 3300024187
• Scaffold ID: Ga0247672_1082343
• Source Dataset Name: Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 555
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location

• Location Name: USA: Indiana
• Coordinates
  • Lat. (^o): 40.4449
  • Long. (^o): -87.0297

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025566	Metagenome / Metatranscriptome	201	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247672_10823432	F025566	N/A	ARRTACQNPRVAPYTWTVREGALDGSVVMREYVYDVPDKEPVEGQELYLSNGTGPWRVILRENVPGVPRSPYNVLVVERVF