NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247669_1004168

Scaffold Ga0247669_1004168


Overview

Basic Information
Taxon OID3300024182 Open in IMG/M
Scaffold IDGa0247669_1004168 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3152
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000696Metagenome / Metatranscriptome931Y
F000739Metagenome / Metatranscriptome913Y
F011614Metagenome / Metatranscriptome289Y

Sequences

Protein IDFamilyRBSSequence
Ga0247669_10041681F011614N/AHIERWVPPEVYGSPRTWYAQTVERENGVSIPALGPYPSRGEYEHCFTLEGPSGEFLQLTPTVAEHVARAIEFSRRSPRSLKKRSLDSRAQREERSYETWAYDQLDDAVPAFHKQPFVTVA
Ga0247669_10041682F000739GGTGGMKQLELKQFEFWLKGVVAAAISGGAGGVLTGFAAVGIDPQHFNLQSGTGATLRIAVAAALINAVIGVAAYLQKSPLPND
Ga0247669_10041683F000696GGAMPVVGSSAYNSAGQITSLVRSLLNDAQGNLFTDTVLLPYANSAYRKLQRALGNAGGGGFIQDDALLVVPAVAQADTSLQVSVTDATAPPNQLPTDLLVPIKIWERPNGSTDDFLEMVDLTQHGGLPSRVQDVTLSVWEWRADGIYFLGATQDTQIRLRYAKAYPDFTDASSPVLVRNAQEAIAYATAALAGWARGSPLAEKWDDAAADAIEDLVSEAVRREQQSARRRRPFSSRSGYTPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.