| Basic Information | |
|---|---|
| Taxon OID | 3300024182 Open in IMG/M |
| Scaffold ID | Ga0247669_1000226 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 27171 |
| Total Scaffold Genes | 32 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 22 (68.75%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Indiana | |||||||
| Coordinates | Lat. (o) | 40.4449 | Long. (o) | -87.0297 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000395 | Metagenome / Metatranscriptome | 1186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247669_10002263 | F000395 | AGGA | MADEGRQKNAMDLLQAWIDDYNARARPEIRLGSAGEAGGAQLRLRYSPVEGQVSIFHMVGVNRDGRAAILVQRFDGPTADTAVEAGLWASRQLGRR |
| ⦗Top⦘ |