NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247669_1000003

Scaffold Ga0247669_1000003


Overview

Basic Information
Taxon OID3300024182 Open in IMG/M
Scaffold IDGa0247669_1000003 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)363817
Total Scaffold Genes307 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)265 (86.32%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012147Metagenome / Metatranscriptome283Y
F021622Metagenome / Metatranscriptome218Y
F056839Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0247669_1000003115F012147N/AMATATSAWNFYPVGSAGHCKTDMSIDELARTYIANVERQQREQSTGRFPWIRGTSARAPHFSAVTRLQSTSGGRVHCEECGLPMSGQSICSGCHASPSRMWLQLFSLGTLGILTAYNYIFVLNFFAPLAPRGHLANVWLNVSEFTWLYGWIVLGVYLPAWAYYGRKRHGYSLEAGVWVGVGFVVILLIGTVARPMFTRMGFTWAERLGISLDSHPALGIVVGWAVVALALISICCNCESRDRLLGRGKGLALLALAVLCIILALSLFAAGGRVV
Ga0247669_100000315F056839GGAGMTGGTNLDGGDVGITPEAGIEILEQRVMQERARVDDLEDLARRNEIEPGTLRGQ
Ga0247669_1000003237F021622AGGMPANFSPPGYRWFHIFRHPAIRVGLYTGVWLSVGFVAWVVIANRVPFLEPLAQERNVIATMALALIAAMPVIRFLRSPGELLISGLLAWSVLALGYRILSLIFVLLQDYYSTFHVFVLGAVAYLLFATLSWIGMIVWRAREAQGTHTPR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.