Scaffold Ga0228668_1000694

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0228668_1000694

Scaffold Ga0228668_1000694

Overview

Basic Information
Taxon OID	3300024180 Open in IMG/M
Scaffold ID	Ga0228668_1000694 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Monterey Bay, California, United States - 82D
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12682
Total Scaffold Genes	24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	36.8313	Long. (^o)	-121.9047	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004358	Metagenome / Metatranscriptome	442	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228668_100069422	F004358	N/A	MFGLITMLLTTLGATGMGSMLKIVGGLFAGISDAKDAKAKRELIRDMQMQKADLEFQKAVFGEMDKDTSAFTRGTRRLIALIGMCNFFVISVLCTLWPGVELVTFTPPENKESFKILWGLVSFPSGADITTSITTGHIALVSIATLGAIIGFYFTPGGKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.