NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247694_1003267

Scaffold Ga0247694_1003267


Overview

Basic Information
Taxon OID3300024178 Open in IMG/M
Scaffold IDGa0247694_1003267 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2427
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000696Metagenome / Metatranscriptome931Y
F000739Metagenome / Metatranscriptome913Y
F016552Metagenome / Metatranscriptome246Y
F018044Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
Ga0247694_10032671F018044N/ASALGPYPSRGEYEHCFTLEGPRGEFLQLTPAAADHVARAIEFSRHLPGATKRRSVNEREEREERAYEAWAYDQLDDAVPAFHKQPFVSVISK
Ga0247694_10032672F000739N/AMKRFELWLKGIVAAAISGGAGGVLTGFAAVGIDPQHFNLQTGTGATMRIAVAAALINSVIGVAAYLQKSPLPED
Ga0247694_10032673F000696AGGAMPVVGSSAYNTAGQITSLVRSLLNDAQGNLFTDTVLLPYANSAYRKLQRALGNAGGGGFIQDDALLVVPAVAQTDTSLQISITDATAPPNQLPTDLLVPIKIWERPSGSSDDFLEMVDLTQHGGLPSRVQDSTLSVWEWRADGIYFLGATQDTQIRLRYAKAYPDFTDATSPVLIRNAQEAVAYATAALAGWARGSPLAEKWDDAAADAIEDLVSAAIRREQQSVRRRRPFSSRSGYTPF
Ga0247694_10032675F016552GAGGMLGSRFAPRLLCRQPGFLRAITMTFFWALVALALHVVPGAVRTAHAQGTRKDDIVFNSRGIPLAGATVRVCAMPASGQPCTPLALIYSDVGLTQALSNPTSTDGLGNYSFYAAPGKYEIEISGPGITTKQLPNVVLPNDPSSPTFSGAVSAFSLSLGGNLTVSGNTTVLGSLASGTLTLNNQGTPPGAPGAGTVNLYT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.