Basic Information | |
---|---|
Taxon OID | 3300024058 Open in IMG/M |
Scaffold ID | Ga0209997_10006269 Open in IMG/M |
Source Dataset Name | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4634 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mariana Trench | |||||||
Coordinates | Lat. (o) | 12.4764 | Long. (o) | 144.8648 | Alt. (m) | Depth (m) | 7939 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087396 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209997_100062695 | F087396 | GGA | VVLPLDGFVLDERALVNSHILPYVQMVASVIEGRMISREELLASLRKSMRQRSIDRLPRREYVLRYLNQHPP |
⦗Top⦘ |