Scaffold Ga0233359_1011838

Overview

Basic Information

• Taxon OID: 3300024049
• Scaffold ID: Ga0233359_1011838
• Source Dataset Name: Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 937
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 40.5253
  • Long. (^o): -123.5031
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058751	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233359_10118381	F058751	GGA	MQLLLNSAVRERIAIGAGAALCLVYVLLAGRLLVASAYGEKPELSSLQRAARLDSGNADYRNHLGRYYALVARDPAAAIVPYRAAVQLNPHSARYWF