| Basic Information | |
|---|---|
| Taxon OID | 3300024049 Open in IMG/M |
| Scaffold ID | Ga0233359_1011838 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 937 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 40.5253 | Long. (o) | -123.5031 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058751 | Metagenome / Metatranscriptome | 134 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0233359_10118381 | F058751 | GGA | MQLLLNSAVRERIAIGAGAALCLVYVLLAGRLLVASAYGEKPELSSLQRAARLDSGNADYRNHLGRYYALVARDPAAAIVPYRAAVQLNPHSARYWF |
| ⦗Top⦘ |