NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228709_1128732

Scaffold Ga0228709_1128732


Overview

Basic Information
Taxon OID3300023708 Open in IMG/M
Scaffold IDGa0228709_1128732 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)515
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003402Metagenome / Metatranscriptome489Y

Sequences

Protein IDFamilyRBSSequence
Ga0228709_11287321F003402N/AREVFDMDFHYNTPKGVYDSLHCACLGCCDPSSGEFISPIVVNGLCNPDDHKVCGPQPRPAGANAIIFSGVGKMKPESDLPGKAKAEEYVIFRVYIEDRSEPGGHHPKGAIEPSDIYCFQAWKTGIPVAKKPDFTTVATKFRTALAQANCKFLDDLKDGNLPIGSLPPSKVG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.