Scaffold Ga0247550_100846

Overview

Basic Information

• Taxon OID: 3300023660
• Scaffold ID: Ga0247550_100846
• Source Dataset Name: Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 872
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.0427
  • Long. (^o): 13.6161

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068489	Metagenome / Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0247550_1008461	F068489	N/A	RAYFRVRWFLPWLSPRTSFRLPWLRFPKPPYDPGQPVFPGPVQTLAFLRRSSRYQRDLSAGTHASLLSPVYHRTRPLNEQGHSLAQWPAAFRPMDRQVPRAPLPGRSVTSAGAMSCIASKGVTLSSLLLRAHAPARLPSAYFSLGLVRRIFAGYCQFLLRVGPSRRYLRETLLGCLDLCHGGIRSALARYFLHIVGLPPRVMGRLPTNFHPMTSWWALFSRLQSFLNVQTSKLACHPGHPYRNGIPIGQPWRLHPGRTCVVTSTCTGYAIRPKRAIDGRGLSPHKSYGIV