NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228696_1040391

Scaffold Ga0228696_1040391


Overview

Basic Information
Taxon OID3300023568 Open in IMG/M
Scaffold IDGa0228696_1040391 Open in IMG/M
Source Dataset NameMetatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)532
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010278Metagenome / Metatranscriptome306Y

Sequences

Protein IDFamilyRBSSequence
Ga0228696_10403912F010278N/AMPFKKSNLRSLVLEVMYEGVHDPVKPGILKKKRLGKLSCSKVKSAKAGLKDKGTHYAKALQRYMNYHCK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.