| Basic Information | |
|---|---|
| Taxon OID | 3300023500 Open in IMG/M |
| Scaffold ID | Ga0257021_1069051 Open in IMG/M |
| Source Dataset Name | Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual Assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Western Washington University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 827 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Loihi Seamount, Hawaii, USA | |||||||
| Coordinates | Lat. (o) | 18.902 | Long. (o) | -155.257 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005399 | Metagenome / Metatranscriptome | 402 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257021_10690511 | F005399 | AGG | MKAAIEYDIFQEMKLEENTGEIVMRPMAEMMDTPLDFIAEEDEPEWTPLLQVLTETMIDPYTVPAEDVVPNEKDYHMIVAASEDLVKVAGDFARKVEGLQTIDPKEYQERVSRFEQGMFWPTEEQKM |
| ⦗Top⦘ |