Scaffold Ga0257021_1021914

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257021_1021914

Scaffold Ga0257021_1021914

Overview

Basic Information
Taxon OID	3300023500 Open in IMG/M
Scaffold ID	Ga0257021_1021914 Open in IMG/M
Source Dataset Name	Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual Assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Western Washington University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1545
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location
Location Name	Loihi Seamount, Hawaii, USA
Coordinates	Lat. (^o)	18.902	Long. (^o)	-155.257	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018940	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257021_10219144	F018940	GAGG	MSYENIEADFHYENSGASHAENEHDENCDWIYDNCTCGLIEAENYDTPDDGDY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.