NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257046_107049

Scaffold Ga0257046_107049


Overview

Basic Information
Taxon OID3300023498 Open in IMG/M
Scaffold IDGa0257046_107049 Open in IMG/M
Source Dataset NameHuman gut microbial communities from healthy child feces in Northridge, California, USA - CDI_30A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Irvine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4053
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Intestinimonas → Intestinimonas butyriciproducens(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location NameUSA: Northridge, California
CoordinatesLat. (o)34.2381Long. (o)-118.5301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029444Metagenome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0257046_1070491F029444N/AMEVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEISGIIAEKESQIFGRRFVGFDS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.