Scaffold Ga0257057_109674

Overview

Basic Information

• Taxon OID: 3300023494
• Scaffold ID: Ga0257057_109674
• Source Dataset Name: Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_85A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Irvine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2122
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location

• Location Name: USA: Northridge, California
• Coordinates
  • Lat. (^o): 34.2381
  • Long. (^o): -118.5301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097493	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257057_1096747	F097493	N/A	YERGVEIDGTVYGIRTDSDILRIKRSVVNSKFAESEEDFDMNVEIAKIQHTDITLEQPTSEQLEQIQAKTYNSMTELKQHVQSVMNGELTQDEINAMLMLQIAELKAGVDGE