Basic Information | |
---|---|
Taxon OID | 3300023491 Open in IMG/M |
Scaffold ID | Ga0257045_100103 Open in IMG/M |
Source Dataset Name | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_28A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Irvine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 108218 |
Total Scaffold Genes | 103 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 90 (87.38%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Northridge, California | |||||||
Coordinates | Lat. (o) | 34.2381 | Long. (o) | -118.5301 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032286 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257045_10010326 | F032286 | N/A | VTPVRHRALIFDVRLFTGNTADDALVTGGTFRFCRLMCLCVKRRNIMLNDKRRSLLNSALFRADNRTGQKTFSPFSLALIFTFDFAALSERRSCPEDCSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDRKGQKIEGRTPLCSQNSPFRNGLKTCA |
⦗Top⦘ |