| Basic Information | |
|---|---|
| Taxon OID | 3300023486 Open in IMG/M |
| Scaffold ID | Ga0257044_14663 Open in IMG/M |
| Source Dataset Name | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_26B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Irvine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2964 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Northridge, California | |||||||
| Coordinates | Lat. (o) | 34.2381 | Long. (o) | -118.5301 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101193 | Metagenome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257044_146633 | F101193 | GGA | MARYNWTRCPHCGKLCKPSRFKAATVLVPIELVIFVVCIFFRNSMNDAIGWFAAWLLFVLLLFLPHYIYVRFFMPYETLSEDETRKFHELQKN |
| ⦗Top⦘ |