Basic Information | |
---|---|
Taxon OID | 3300023481 Open in IMG/M |
Scaffold ID | Ga0257022_1029116 Open in IMG/M |
Source Dataset Name | Marine microbial mat from Loihi Seamount, Hawaii, USA - Ku'kulu Base Individual Assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Western Washington University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1006 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Loihi Seamount, Hawaii, USA | |||||||
Coordinates | Lat. (o) | 18.903 | Long. (o) | -155.257 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078828 | Metagenome | 116 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257022_10291162 | F078828 | AGG | MEKKDTQYNWSELCYKVDPELSSPVKQYVFDNGNKIFYKPKKRIKYGNRKSGH |
⦗Top⦘ |