Scaffold Ga0257022_1011894

Overview

Basic Information

• Taxon OID: 3300023481
• Scaffold ID: Ga0257022_1011894
• Source Dataset Name: Marine microbial mat from Loihi Seamount, Hawaii, USA - Ku'kulu Base Individual Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Western Washington University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1703
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location

• Location Name: Loihi Seamount, Hawaii, USA
• Coordinates
  • Lat. (^o): 18.903
  • Long. (^o): -155.257

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048920	Metagenome	147	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257022_10118942	F048920	AGGAGG	MAQTEPKPKPDHELVNELALAKAEADEAKERYETLRFEVKERIQEKPGRMVIFGGTHEAELEEVWDKKEGRYDPTRLVQFREKADQHTAELLYGDAWIPEATKVIPGHWDIVQLKASAKRHGDLGEVEAAKIPPGYRVKLVKRK