Scaffold Ga0256747_1315037

Overview

Basic Information

• Taxon OID: 3300023444
• Scaffold ID: Ga0256747_1315037
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 675-SC9
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 711
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: USA: Loihi Seamount, Hawaii
• Coordinates
  • Lat. (^o): 18.906379
  • Long. (^o): -155.256927
  • Depth (m): 1299.98

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035080	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256747_13150372	F035080	GGA	MPKKDLTTINNVDISPLVRELVEYSKSKNAIGDLEELVSKVPMGNSPDWKLISGVLCNSIVEWASQNKEGKELIQHLQSDIGYLLKRMGLTQ