| Basic Information | |
|---|---|
| Taxon OID | 3300023444 Open in IMG/M |
| Scaffold ID | Ga0256747_1279158 Open in IMG/M |
| Source Dataset Name | Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 675-SC9 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Delaware |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 764 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Loihi Seamount, Hawaii | |||||||
| Coordinates | Lat. (o) | 18.906379 | Long. (o) | -155.256927 | Alt. (m) | Depth (m) | 1299.98 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003616 | Metagenome | 477 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256747_12791582 | F003616 | AGGA | MIWSEKLGHEIGTYNSLGGLRINPKPFIHSTQNTVVTCRICKGVGCNAITHESGLVTLNPCVLCKGAKRRSNRIG |
| ⦗Top⦘ |