| Basic Information | |
|---|---|
| Taxon OID | 3300023442 Open in IMG/M |
| Scaffold ID | Ga0256751_1096532 Open in IMG/M |
| Source Dataset Name | Hydrothermal Fe-rich mat microbial community from Rainbow Site, Mid-Atlantic Ridge, Atlantic Ocean - 664-SC8 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Delaware |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1113 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | International: Rainbow Site, Mid-Atlantic Ridge | |||||||
| Coordinates | Lat. (o) | 36.229322 | Long. (o) | -33.902767 | Alt. (m) | Depth (m) | 2294.86 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029294 | Metagenome | 189 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0256751_10965322 | F029294 | AGG | MQEIGETRDAIIEDDNKKIEEIVNANKNRKEPYWIVLFAKPSKISIDGKPTLIKHIKAYYKRPVSQVGMVIGEVNNAEGTVKWEVNMPQRPFDYDALITLGAKETKEVIVETTSIPYAYVTK |
| ⦗Top⦘ |