Scaffold Ga0256750_1154626

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256750_1154626

Scaffold Ga0256750_1154626

Overview

Basic Information
Taxon OID	3300023440 Open in IMG/M
Scaffold ID	Ga0256750_1154626 Open in IMG/M
Source Dataset Name	Hydrothermal Fe-rich mat microbial community from Rainbow Site, Mid-Atlantic Ridge, Atlantic Ocean - 664-BS3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Delaware
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	642
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location Name	International: Rainbow Site, Mid-Atlantic Ridge
Coordinates	Lat. (^o)	36.229324	Long. (^o)	-33.902768	Alt. (m)		Depth (m)	2294.78
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089415	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0256750_11546262	F089415	AGGAG	VQRLQANLYSVFLTEEREGPPNEADWLYESDICRRELPSGSGRTYCESLKPDSLHVAQYLAYHRIKWFDGTKGKMVVGKRGQPRMCRCGDTESDTGAVKPQMW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.