Scaffold Ga0256753_1006372

Overview

Basic Information

• Taxon OID: 3300023368
• Scaffold ID: Ga0256753_1006372
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from Snakepit Site, Mid-Atlantic Ridge, Atlantic Ocean - 667-BS4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3747
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: International: Snakepit Site, Mid-Atlantic Ridge
• Coordinates
  • Lat. (^o): 23.369112
  • Long. (^o): -44.950984
  • Depth (m): 3504.92

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024166	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256753_10063721	F024166	AGG	VRSRFDDHWARGFEVCDAIDEADGLHYRLRRRSDGSILPVLFADDDVREEKRRAMWWI