Scaffold Ga0256681_12197125

Overview

Basic Information

• Taxon OID: 3300023311
• Scaffold ID: Ga0256681_12197125
• Source Dataset Name: Combined Assembly of Gp0281739, Gp0281740, Gp0281741
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Laval University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 636
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location

• Location Name: SAS2a, Kuujjuarapick, Canada
• Coordinates
  • Lat. (^o): 55.1491
  • Long. (^o): -77.4866

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060712	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256681_121971252	F060712	AGG	MTTITDIVNRALQVPGTRTSVTDAELAGNLTNEAIQANLCLTNIRRRLLRMAPWNCSVKGANLVYITSSPGTPENTSAATTLWQPGQPVPPWAYEYQYPVDCVRPCWMIPATQTGYAGGI