Basic Information | |
---|---|
Taxon OID | 3300023311 Open in IMG/M |
Scaffold ID | Ga0256681_10521548 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Laval University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4126 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (91.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | SAS2a, Kuujjuarapick, Canada | |||||||
Coordinates | Lat. (o) | 55.1491 | Long. (o) | -77.4866 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031035 | Metagenome | 183 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256681_105215487 | F031035 | GGAG | MDKELINLRIQDLIFKGKELEQQLHQINGALQQCQWTLAELEKANASEEIDKPESV |
⦗Top⦘ |