Scaffold Ga0209414_1057097

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209414_1057097

Scaffold Ga0209414_1057097

Overview

Basic Information
Taxon OID	3300023301 Open in IMG/M
Scaffold ID	Ga0209414_1057097 Open in IMG/M
Source Dataset Name	Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1051
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location Name	Lake Vida, Antarctica
Coordinates	Lat. (^o)	-77.38861	Long. (^o)	161.931111	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104016	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209414_10570972	F104016	AGG	MEDLMSSIPGRTNDLEKDMHTVKHRLTQLEELPPKVNELQRSFSVMESNLEYIKNTGTATKHVVDELNNSYKTLIGELKGVPRALNMVAGLIAIGGIGVSVVLYFQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.