Scaffold Ga0256702_11472540

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256702_11472540

Scaffold Ga0256702_11472540

Overview

Basic Information
Taxon OID	3300023300 Open in IMG/M
Scaffold ID	Ga0256702_11472540 Open in IMG/M
Source Dataset Name	Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	844
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	Durham, Ontario, Canada
Coordinates	Lat. (^o)	44.1763	Long. (^o)	-80.8185	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001813	Metagenome	630	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256702_114725401	F001813	N/A	GVTEPGGVQRAFGRCVEGHGLARTIGEGRMVGLGDPVGLFQP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.