Scaffold Ga0256703_10929983

Overview

Basic Information

• Taxon OID: 3300023291
• Scaffold ID: Ga0256703_10929983
• Source Dataset Name: Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 660
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.6629
  • Long. (^o): -79.3957

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038084	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256703_109299831	F038084	AGGTGG	MPISFRIFQFIVIHTVKGFGIVNKAEIDVFLELSCFFDDPADVSNLMSASSAFSKTSLNIWKFTAHVLLEPGLENF