Scaffold Ga0255813_11959031

Overview

Basic Information

• Taxon OID: 3300023280
• Scaffold ID: Ga0255813_11959031
• Source Dataset Name: Combined Assembly of Gp0238881, Gp0242115
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 963
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: Durham, Ontario, Canada
• Coordinates
  • Lat. (^o): 44.1763
  • Long. (^o): -80.8185

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028669	Metagenome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255813_119590312	F028669	AGGAGG	MYTRREIKKQRFKCWSDQFITNVSKGDEERGRWTVLQIGVMGKGRRAVEKIENRSKEAL