NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224544_1027713

Scaffold Ga0224544_1027713


Overview

Basic Information
Taxon OID3300023250 Open in IMG/M
Scaffold IDGa0224544_1027713 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)793
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3533Long. (o)19.0471Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011332Metagenome / Metatranscriptome292Y

Sequences

Protein IDFamilyRBSSequence
Ga0224544_10277132F011332N/AHREMLEAIRDGRLDSIIDKRETPETLAAVKQLDLEWVNAGSVHSNGALTMHIRVTDGGATVEGARLTLRFARPDSAPYYAQVLTDNLGNAEMSVQVDEKSLPDSSVVVQVYFDGRTATRKFQLRPAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.