NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233412_10000828

Scaffold Ga0233412_10000828


Overview

Basic Information
Taxon OID3300023210 Open in IMG/M
Scaffold IDGa0233412_10000828 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)17205
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (6.90%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6569Long. (o)-123.4875Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004953Metagenome / Metatranscriptome417Y
F023555Metagenome / Metatranscriptome209Y
F025977Metagenome / Metatranscriptome199Y
F048942Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0233412_1000082810F025977N/AMTEIFKKLADNGITPNAFYILNCIKEGLVPNTYVKASLEVTRLIRDSWLTENLELTDKSIIFTVEIDGYFKKSKKKTSTNLLGHHFMQNMEAYVHIFPNKKLSSGKYARVPAKNLESAFRWFFETYNYDWETIFQATQKYVAEYESKNYEYMRTAQYFLRKQNVDKSWDSDLAIYCEYLKDNPDDDKVYFSELIV
Ga0233412_1000082812F023555N/AMSGNLRKEKEKEFYMQHMDAFKAIGIADPFFTIKTAFFKKGKFGRQCQFFEWELKKEEDIYIEFYDNAYDGNGKIIDILPMNEDRSLFKLKYNPYFNEEYDVVDGVDSEGKPNNKYLVPVNEMVVVLSSGQEISYSLYEKRKEDAKNDLPELQKSLGLFPNFEKEYSPKVEGLALNAKDDSIIEICKRISNDFEKLATLLSKITLK
Ga0233412_1000082828F004953N/AMMLVQATWQESQTFRMIPISTDCPYVECIYDPATNVFVAISNIKKTTLHMLPKLDEYGQNITGNKGPKQERHKLEVFQEFYVEDKKATEELINLFAINADSFDYKKFMKEAKKA
Ga0233412_100008288F048942N/AMIKVKELKDDAIITIEVNKNFYLMTKAASFVILQSMNIPEKGDAYFKDIMSKEYNSLDEQQRAFYTIALLLAEIESQATKNKLYTEKEIAEPGEEGYIEPTLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.