Scaffold Ga0233424_10003476

Overview

Basic Information

• Taxon OID: 3300023208
• Scaffold ID: Ga0233424_10003476
• Source Dataset Name: Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 10151
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (92.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Indonesia: South Sulawesi
• Coordinates
  • Lat. (^o): -2.7
  • Long. (^o): 121.4042
  • Depth (m): 125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038588	Metagenome / Metatranscriptome	165	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0233424_100034762	F038588	AGGAG	MGTVLELSDDTYQQLAELAHEQQRTPEDMLRVCLATYEAARYERVHRQMVAEGLLEALPTRPLPPELEDFAPEAIPGPPLSETLLEDRR