Scaffold Ga0255814_11674817

Overview

Basic Information

• Taxon OID: 3300023205
• Scaffold ID: Ga0255814_11674817
• Source Dataset Name: Combined Assembly of Gp0242100, Gp0242119
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 548
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: Durham, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.6629
  • Long. (^o): -79.3957

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055475	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255814_116748172	F055475	GGA	MDTNNTPQVDSSITRARARQLNLQVISFLSNYSCAFESSMLPNDFIVLRNEGEDQHRCMKVLGGGEDQLGRLDQDGGPNRFEFISVSDSRNNP