Basic Information | |
---|---|
Taxon OID | 3300023205 Open in IMG/M |
Scaffold ID | Ga0255814_10529539 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0242100, Gp0242119 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1080 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Durham, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012765 | Metagenome / Metatranscriptome | 277 | Y |
F065522 | Metagenome | 127 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255814_105295391 | F065522 | N/A | VPFCFSLPSLWTALPSDPVLFDYLLLGMTRQISTLEEKHSRDQAELVQRCADFEEKYSQSQTELGQVSAALDDANALSSSLHAQLDSEKVIYKTVLCLAVFLLLAWFLKELIFARRKKSVSSLPLVTVLTDCIAILATR |
Ga0255814_105295392 | F012765 | AGGAG | MEELDNQRCKLQESADEVTRLKQLISAKDATIKELRASKKSIVQELETARLAAKVAEETSVTLRAQRDRAMDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSSRPSSSVAPEKDIAK |
⦗Top⦘ |