NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214923_10125778

Scaffold Ga0214923_10125778


Overview

Basic Information
Taxon OID3300023179 Open in IMG/M
Scaffold IDGa0214923_10125778 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1660
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003663Metagenome / Metatranscriptome474Y
F074872Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0214923_101257782F074872N/AMSDPFAIIRPYKKGSKMTIDNKTYAVGDLFTTLKSKETGVIKEIISNASGSVRVRLETENGERWTTISADSLA
Ga0214923_101257784F003663AGGTGGMLSTATALLDATRDSIFDKDIMELAGELHTRRNELTDEIFAKYLFMYSSAVAAKVADSITKVLLTEQEMSDLCATIDEMENLSETILEENE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.