| Basic Information | |
|---|---|
| Taxon OID | 3300023179 Open in IMG/M |
| Scaffold ID | Ga0214923_10023150 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5449 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (73.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 34.2611 | Long. (o) | -83.95 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004111 | Metagenome / Metatranscriptome | 452 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214923_1002315010 | F004111 | AGG | MIEKIKQVNDLCAAHGTYINQHGKKTVSAWSKIKYFREVFGTEFGINCRIVEHSDRYVIMKCEILGYDPERIVASGYSKQFRDKPGYLEIAETFAITRALSFMGLCLEDLTSKEEYEELDIPVQPMNTKDTTSANNRYDVDVVNELIKKVSFAPHTAKLDFLWRANKDLLNQIKIKDQSTYNSILQRFNSKRDEITTQNEV |
| ⦗Top⦘ |