NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214923_10022884

Scaffold Ga0214923_10022884


Overview

Basic Information
Taxon OID3300023179 Open in IMG/M
Scaffold IDGa0214923_10022884 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5492
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000635Metagenome / Metatranscriptome970Y
F003112Metagenome / Metatranscriptome506N
F039992Metagenome / Metatranscriptome162N
F081071Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0214923_100228841F081071AGGMTAVEFIEASGVPESTWPTFREWYGWHSDRGLVGVAKDGDEVAGVAIARCVKGLEAPDPYEHDEAGENVFVDLTVTSIGGITTDLSRKALKCLLSILWDRFGPRRRITFKRNGFYKEYDYYKFMRKALN
Ga0214923_100228843F000635GGAGGLTLSEIATFAGEKIGKTDSDTVTFLKKSASLNYRRVWNFAPWRESVTTSTYSVGTNRTITLGTSVETPLSVAYDKSEVEPIDLSTIVSQDADLLEDTRTGTPVLYHFTGRNSSGVAELDLYPRLETAGTIALRVVEKLKCVTRNNYIVDFPPSVSALDDELRLPHVHQVILALTHADALERERQYAKAQSVVQTANADLAAMANYELSQVGGMKQITPSSLGDLSIEEISAS
Ga0214923_100228845F039992GGAGGVSLDEIHDLRDKVQTVSERLARMEERQVTLIGMVERSLSSFGDLSNRVTSLEHLKTKMLLVAGGIGAIVSVVWDAIRSRLTQGG
Ga0214923_100228846F003112N/AMIKSIAIWLTNLSLRFLMTQKEYACFKEALRFAGENNTVAKETKYIGKVKHLLSVNRSIKRIVEEGRDRDEIVDAVVHLAVALKYLEGKGRES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.