Scaffold Ga0233423_10000044

Overview

Basic Information

• Taxon OID: 3300023177
• Scaffold ID: Ga0233423_10000044
• Source Dataset Name: Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_112_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 76295
• Total Scaffold Genes: 67
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 41 (61.19%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Indonesia: South Sulawesi
• Coordinates
  • Lat. (^o): -2.4667
  • Long. (^o): 121.2833
  • Depth (m): 112

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089118	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233423_100000445	F089118	N/A	VTRLVWTIIFALLIGAIVIVSLKSLPGTRVNKRLVEMERARNVLSQTFPDSRFRMQLSAPDPGVRNLVVTIQPGRADSASVAAQVDSTESVVRRSVDLTGFDSLVVVVFDRVYRTVPAR