NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214921_10003698

Scaffold Ga0214921_10003698


Overview

Basic Information
Taxon OID3300023174 Open in IMG/M
Scaffold IDGa0214921_10003698 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23143
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (28.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009453Metagenome / Metatranscriptome317Y
F014361Metagenome / Metatranscriptome263Y

Sequences

Protein IDFamilyRBSSequence
Ga0214921_1000369821F009453N/AMAQAGTLLSDLDSKPPVFSNKDDDLVNKILTDMNIPSQSNPIMNSPPPPSGNGRVMNSPNPNSTYPVAMDPGTATAHMIGKDYPTPADFAHLMHSQQFSHGGSQFANVPQRTQQIQQPTLIESFKGNMYSDIMSQIKQPLLVAIIIFIVSLPIVNVLIGHYLPSLLRIGGDLTTAGLGVKALVGGFLFWFIQKVLVPLMVV
Ga0214921_100036986F014361N/AMSALNAFTTQLVNFFEELCTTFPEERDIKLATEAITGAKKINPRLILDLFTEHVYIELASSITNRDIGHIRQIAQKKLSTQFNEMISALAIFDKHWDTMGSANQEVIWRYLKVLSVLSEKARAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.