| Basic Information | |
|---|---|
| Taxon OID | 3300023119 Open in IMG/M |
| Scaffold ID | Ga0255762_10535247 Open in IMG/M |
| Source Dataset Name | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 541 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 31.972 | Long. (o) | -81.028 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068306 | Metagenome / Metatranscriptome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255762_105352471 | F068306 | N/A | MQKIWFVLLLFLSGLASSNQNANFDHEIKVDIKDIRSDFHEKNENFFLTILNGIKGQRDNYYSFDSLNDIKVKPPEGYIEDKKSNSEVTYSHQESKILSFCSKKITLKLDPSDEYFITLKHLDKEILGADKSEYPLYENTNLAIYKKDEK |
| ⦗Top⦘ |