| Basic Information | |
|---|---|
| Taxon OID | 3300023101 Open in IMG/M |
| Scaffold ID | Ga0224557_1215843 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 656 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Norrbotten County, Stordalen Mire | |||||||
| Coordinates | Lat. (o) | 68.3532 | Long. (o) | 19.0475 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038945 | Metagenome | 164 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224557_12158432 | F038945 | N/A | KDVFASCKKAALREFSALSAGVETGAAGTKDFNNTFTMNIERPPNGALTQNLRIAVKPLPGKREELAAIFGKCAWYHSNQSGRTPEEKEQRRAARSNTTQELGR |
| ⦗Top⦘ |