Scaffold Ga0247793_1015885

Overview

Basic Information

• Taxon OID: 3300023066
• Scaffold ID: Ga0247793_1015885
• Source Dataset Name: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1065
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.3
  • Long. (^o): -89.38
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100610	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0247793_10158852	F100610	N/A	MDIIEFGLTNKSDFYRCSYGECFRFIADKYIHRCANPIPDTKRITALSIILRCPPDFKKPVTDLGI