Scaffold Ga0224519_1007542

Overview

Basic Information

• Taxon OID: 3300023060
• Scaffold ID: Ga0224519_1007542
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - IR.B.S.T0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 1049
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3529
  • Long. (^o): 19.0475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080801	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224519_10075421	F080801	AGGAG	VSDEVELPSLVVKTAKSVFRLRCHAAAWAGEYGGSVQVYRRRSEDYAGLLLLSASGPDTAAKSLRATLYEPEVRAEFSLQGSNVAARMIKASLLFGGKPVTYGAAVSKLARGVIHLVAVAKIPGLMPNLSDDHLWAELSGPNYTTPLLRPWIPWLKQAMTKTGNIIVADGLAATVGVLK