Scaffold Ga0233358_100440

Overview

Basic Information

• Taxon OID: 3300023014
• Scaffold ID: Ga0233358_100440
• Source Dataset Name: Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P29
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1310
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 40.5452
  • Long. (^o): -123.5105
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050386	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233358_1004401	F050386	N/A	SRKSYQWKRISEVHKLMVDIQTAHAKLGSQDGNSREHEIKVPNDY