Basic Information | |
---|---|
Taxon OID | 3300022920 Open in IMG/M |
Scaffold ID | Ga0233426_10245392 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 714 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: British Columbia | |||||||
Coordinates | Lat. (o) | 48.5847 | Long. (o) | -123.5008 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026278 | Metagenome / Metatranscriptome | 198 | Y |
F027898 | Metagenome / Metatranscriptome | 193 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0233426_102453921 | F026278 | N/A | TSVAVFHKDVSLTQIIAIGELEVKGKVKKRTTQRGTSKTISTSTLVVAQDGTFNQQTASIALKKVCEQIIKDLL |
Ga0233426_102453922 | F027898 | AGGA | MKKILVLLVSVLFTLSSFGQSSIDYSPVNTVTQVGDTLIMKFQYFKGDGANLTLGQLDFEYNNKLLSYISHESQAPSGASFARNNWTGYEYVPKANSDEDDMDVQYIYWRDEAGGNSYSTSADWSIERITLQSASALENGQEFVKYEFKVKDKFNSGYSDYNDI |
⦗Top⦘ |