NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247774_1001645

Scaffold Ga0247774_1001645


Overview

Basic Information
Taxon OID3300022903 Open in IMG/M
Scaffold IDGa0247774_1001645 Open in IMG/M
Source Dataset NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11187
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038520Metagenome / Metatranscriptome165Y
F042091Metagenome / Metatranscriptome159N
F042710Metagenome157N

Sequences

Protein IDFamilyRBSSequence
Ga0247774_100164515F042091GGAGMTFSDGCPGGRSQLFTFKAKETITVDRPTLEHIFALLNGCSANFKYLCDNDIFVFATKNYLASLDNPESGKALNLLGVWTDTWPDASEELGDGLDEAVQSIKFILAATAGGRND
Ga0247774_10016458F042710GGAGMAENSGNNCERSQIFTASSAQECRYVDVLKARAQELGLDSNCVGDKRKRETWETLLDSYGEAKPVKPQFVVKPNQP
Ga0247774_10016459F038520N/AMKHKRSKHGGKRLGSGRPHKWQGGATKLVRIPISYVEQILRVVDYMDANEGRLPTGIAFHTEGENFTMPGCDPSSELPYPDFDGYNERYRNSTWNR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.