Scaffold Ga0247778_1005087

Overview

Basic Information

• Taxon OID: 3300022894
• Scaffold ID: Ga0247778_1005087
• Source Dataset Name: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3091
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.3
  • Long. (^o): -89.38
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015225	Metagenome / Metatranscriptome	256	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247778_10050873	F015225	N/A	MKSSHGTFAAIVWIVAGALLYNTEPEAKLFSWQTAVFFVPGMFLAGAVLGSLSYAGVRGLTHALVTTKIVTAPTRRAQIGLTVAGYFIFATQVALIYLIAKWTIRLLFQVDEPFQADGPF